SCOPe 2.08: Domain d5uknl2: 5ukn L:108-209

Lineage for d5uknl2 (5ukn L:108-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d5uknl2: 5ukn L:108-209 [342547]
   Other proteins in same PDB: d5uknh1, d5uknh2, d5uknl1
   automated match to d1aqkl2
   complexed with cl

Details for d5uknl2

PDB Entry: 5ukn, 1.75 Å

PDB Description: structure of unliganded anti-gp120 cd4bs antibody dh522uca fab

PDB Compounds: (L:) DH522UCA Fab fragment light chain

SCOPe Domain Sequences for d5uknl2:

Sequence; same for both SEQRES and ATOM records:

>d5uknl2 b.1.1.2 (L:108-209) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasptvtlfppsseelqankatlvclisdfypgvvkvawkadgsavnagvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvapa

Timeline for d5uknl2:

• d5uknl2 first appeared in SCOPe 2.06
  
• d5uknl2 appears in SCOPe 2.07