Lineage for d5uknl1 (5ukn L:3-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2371583Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (33 PDB entries)
  8. 2371596Domain d5uknl1: 5ukn L:3-107 [342546]
    Other proteins in same PDB: d5uknl2
    automated match to d1aqkl1
    complexed with cl

Details for d5uknl1

PDB Entry: 5ukn (more details), 1.75 Å

PDB Description: structure of unliganded anti-gp120 cd4bs antibody dh522uca fab
PDB Compounds: (L:) DH522UCA Fab fragment light chain

SCOPe Domain Sequences for d5uknl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uknl1 b.1.1.0 (L:3-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
altqppsvskslgqsvtisctgtssdiggyngvswyqqhsgtaprlliyevskrpsgvsd
rfsgsksgntasltisglqaedeadyycgsyrsgstwvfgggtrltvlg

SCOPe Domain Coordinates for d5uknl1:

Click to download the PDB-style file with coordinates for d5uknl1.
(The format of our PDB-style files is described here.)

Timeline for d5uknl1: