Lineage for d5x6ub_ (5x6u B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211247Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2211248Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2211279Protein automated matches [190414] (3 species)
    not a true protein
  7. 2211289Species Human (Homo sapiens) [TaxId:9606] [187290] (9 PDB entries)
  8. 2211299Domain d5x6ub_: 5x6u B: [342532]
    Other proteins in same PDB: d5x6ua2
    automated match to d1szva_

Details for d5x6ub_

PDB Entry: 5x6u (more details), 2.4 Å

PDB Description: crystal structure of human heteropentameric complex
PDB Compounds: (B:) Ragulator complex protein LAMTOR2

SCOPe Domain Sequences for d5x6ub_:

Sequence, based on SEQRES records: (download)

>d5x6ub_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngnqa
fnednlkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqva
as

Sequence, based on observed residues (ATOM records): (download)

>d5x6ub_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaltqvlsqantggvqstlllnnegsllaysgygdtdarvtaaiasniwaaydrngedn
lkfilmdcmegrvaitrvanlllcmyaketvgfgmlkakaqalvqyleepltqvaas

SCOPe Domain Coordinates for d5x6ub_:

Click to download the PDB-style file with coordinates for d5x6ub_.
(The format of our PDB-style files is described here.)

Timeline for d5x6ub_: