![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) ![]() alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
![]() | Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
![]() | Protein automated matches [190414] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries) |
![]() | Domain d5x6ua1: 5x6u A:2-123 [342528] Other proteins in same PDB: d5x6ua2 automated match to d1veta_ |
PDB Entry: 5x6u (more details), 2.4 Å
SCOPe Domain Sequences for d5x6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x6ua1 d.110.7.1 (A:2-123) automated matches {Human (Homo sapiens) [TaxId: 9606]} addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvv ev
Timeline for d5x6ua1: