SCOPe 2.06: Domain d5x6ua1: 5x6u A:2-123

Lineage for d5x6ua1 (5x6u A:2-123)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein automated matches [190414] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187290] (9 PDB entries)

8. Domain d5x6ua1: 5x6u A:2-123 [342528]
   Other proteins in same PDB: d5x6ua2
   automated match to d1veta_

Details for d5x6ua1

PDB Entry: 5x6u, 2.4 Å

PDB Description: crystal structure of human heteropentameric complex

PDB Compounds: (A:) Ragulator complex protein LAMTOR3

SCOPe Domain Sequences for d5x6ua1:

Sequence; same for both SEQRES and ATOM records:

>d5x6ua1 d.110.7.1 (A:2-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvv
ev

Timeline for d5x6ua1:

• d5x6ua1 is new in SCOPe 2.06-stable
  
• d5x6ua1 appears in SCOPe 2.07
  
• d5x6ua1 appears in the current release, SCOPe 2.08