Lineage for d5x6ua1 (5x6u A:2-123)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971065Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2971066Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2971097Protein automated matches [190414] (3 species)
    not a true protein
  7. 2971107Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)
  8. 2971116Domain d5x6ua1: 5x6u A:2-123 [342528]
    Other proteins in same PDB: d5x6ua2
    automated match to d1veta_

Details for d5x6ua1

PDB Entry: 5x6u (more details), 2.4 Å

PDB Description: crystal structure of human heteropentameric complex
PDB Compounds: (A:) Ragulator complex protein LAMTOR3

SCOPe Domain Sequences for d5x6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x6ua1 d.110.7.1 (A:2-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
addlkrflykklpsveglhaivvsdrdgvpvikvandnapehalrpgflstfalatdqgs
klglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelrqvv
ev

SCOPe Domain Coordinates for d5x6ua1:

Click to download the PDB-style file with coordinates for d5x6ua1.
(The format of our PDB-style files is described here.)

Timeline for d5x6ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5x6ua2
View in 3D
Domains from other chains:
(mouse over for more information)
d5x6ub_