Lineage for d5vf5a2 (5vf5 A:175-398)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404400Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2404401Protein automated matches [190388] (28 species)
    not a true protein
  7. 2404520Species Solanum melongena [TaxId:4111] [342484] (1 PDB entry)
  8. 2404522Domain d5vf5a2: 5vf5 A:175-398 [342486]
    automated match to d1ipkc2
    complexed with act, cu, mli, na, peg

Details for d5vf5a2

PDB Entry: 5vf5 (more details), 1.49 Å

PDB Description: crystal structure of the vicilin from solanum melongena, re-refinement
PDB Compounds: (A:) SM80.1 Vicilin

SCOPe Domain Sequences for d5vf5a2:

Sequence, based on SEQRES records: (download)

>d5vf5a2 b.82.1.0 (A:175-398) automated matches {Solanum melongena [TaxId: 4111]}
qqkqgaiikaseeqiraisehasrstqqtrgrtqgpfnlmkerpqfgsrfgqfieasper
feqlrdldaavafmninqggmvlpyynsrstrvvmvvegnarfemacphlgrqgrgqgge
qeqeqeegevhyqkvrgnlnvgdvlvipaghpitfiatggsnfrvvgfginamfnrknfl
agreniwrnidreakelsfnmpgreveeifqkqdqsyfvagpeh

Sequence, based on observed residues (ATOM records): (download)

>d5vf5a2 b.82.1.0 (A:175-398) automated matches {Solanum melongena [TaxId: 4111]}
qqkqgaiikaseeqiraisehasrtqgpfnlmkerpqfgsrfgqfieasperfeqlrdld
aavafmninqggmvlpyynsrstrvvmvvegnarfemacphlggevhyqkvrgnlnvgdv
lvipaghpitfiatggsnfrvvgfginamfnrknflagreniwrnidreakelsfnmpgr
eveeifqkqdqsyfvagpeh

SCOPe Domain Coordinates for d5vf5a2:

Click to download the PDB-style file with coordinates for d5vf5a2.
(The format of our PDB-style files is described here.)

Timeline for d5vf5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vf5a1