Lineage for d1booa_ (1boo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129507Family c.66.1.11: Type II DNA methylase [53377] (3 protein domains)
    circularly permuted version of the common fold
  6. 2129508Protein m.PvuII N4 cytosine-specific DNA methyltransferase [53378] (1 species)
  7. 2129509Species Proteus vulgaris [TaxId:585] [53379] (1 PDB entry)
  8. 2129510Domain d1booa_: 1boo A: [34248]
    complexed with sah

Details for d1booa_

PDB Entry: 1boo (more details), 2.8 Å

PDB Description: pvuii dna methyltransferase (cytosine-n4-specific)
PDB Compounds: (A:) protein (n-4 cytosine-specific methyltransferase pvu II)

SCOPe Domain Sequences for d1booa_:

Sequence, based on SEQRES records: (download)

>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]}
nfgkkpayttsngsmyigdslellesfpeesislvmtsppfalqrkkeygnleqheyvdw
flsfakvvnkklkpdgsfvvdfggaymkgvparsiynfrvlirmidevgfflaedfywfn
psklpspiewvnkrkirvkdavntvwwfsktewpksditkvlapysdrmkkliedpdkfy
tpktrpsghdigksfskdnggsippnllqisnsesngqylancklmgikahparfpaklp
effirmltepddlvvdifggsnttglvaeresrkwisfemkpeyvaasafrfldnnisee
kitdiynrilngesldlnsi

Sequence, based on observed residues (ATOM records): (download)

>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]}
nfgkkpayttsngsmyigdslellesfpeesislvmtsppfalqrkkeygnleqheyvdw
flsfakvvnkklkpdgsfvvdfggaymkgvparsiynfrvlirmidevgfflaedfywfn
psklpspiewvnkrkirvkdavntvwwfsktewpksditkvlasippnllqisnsesngq
ylancklmgikahparfpaklpeffirmltepddlvvdifggsnttglvaeresrkwisf
emkpeyvaasafrfldnniseekitdiynrilngesldlnsi

SCOPe Domain Coordinates for d1booa_:

Click to download the PDB-style file with coordinates for d1booa_.
(The format of our PDB-style files is described here.)

Timeline for d1booa_: