Lineage for d1g55a_ (1g55 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129999Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 protein domains)
    automatically mapped to Pfam PF00145
  6. 2130030Protein DNMT2 [53375] (1 species)
    an enigmatic DNA methyltransferase homologue from mitochondria
  7. 2130031Species Human (Homo sapiens) [TaxId:9606] [53376] (1 PDB entry)
  8. 2130032Domain d1g55a_: 1g55 A: [34247]
    complexed with bme, gol, sah, so4

Details for d1g55a_

PDB Entry: 1g55 (more details), 1.8 Å

PDB Description: Structure of human DNMT2, an enigmatic DNA methyltransferase homologue
PDB Compounds: (A:) DNA cytosine methyltransferase dnmt2

SCOPe Domain Sequences for d1g55a_:

Sequence, based on SEQRES records: (download)

>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]}
eplrvlelysgvggmhhalrescipaqvvaaidvntvanevykynfphtqllaktiegit
leefdrlsfdmilmsppcqpftrigrqgdmtdsrtnsflhildilprlqklpkyillenv
kgfevsstrdlliqtiencgfqyqefllsptslgipnsrlryfliaklqseplpfqapgq
vlmefpkieihrknqqdsdlsvkmlkdfleddtdvnqyllppksllryallldivqptcr
rsvcftkgygsyiegtgsvlqtaedvqveniyksltnlsqeeqitkllilklryftpkei
anllgfppefgfpekitvkqryrllgnslnvhvvaklikilye

Sequence, based on observed residues (ATOM records): (download)

>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]}
eplrvlelysgvggmhhalrescipaqvvaaidvntvanevykynfphtqllaktiegit
leefdrlsfdmilmsppnsflhildilprlqklpkyillenvkgfevsstrdlliqtien
cgfqyqefllsptslgipnsrlryfliaklqseplpfqapgqvlmefpklsvkmlkdfle
ddtdvnqyllppksllryallldivqptcrrsvcftkgygsyiegtgsvlqtaedvqven
iyksltnlsqeeqitkllilklryftpkeianllgfppefgfpekitvkqryrllgnsln
vhvvaklikilye

SCOPe Domain Coordinates for d1g55a_:

Click to download the PDB-style file with coordinates for d1g55a_.
(The format of our PDB-style files is described here.)

Timeline for d1g55a_: