SCOPe 2.06: Domain d5vpib1: 5vpi B:1-169

Lineage for d5vpib1 (5vpi B:1-169)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d5vpib1: 5vpi B:1-169 [342462]
   Other proteins in same PDB: d5vpia2, d5vpib2
   automated match to d4obea_
   complexed with gtp, mg; mutant

Details for d5vpib1

PDB Entry: 5vpi, 1.62 Å

PDB Description: crystal structure of human kras g12a mutant in complex with gtp

PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d5vpib1:

Sequence, based on SEQRES records:

>d5vpib1 c.37.1.8 (B:1-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaagvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

Sequence, based on observed residues (ATOM records):

>d5vpib1 c.37.1.8 (B:1-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaagvgksaltiqliqnhfvdeydpedsyrkqvvidgetclldildtadqy
mrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqaq
dlarsygipfietsaktrqgvddafytlvreirkhkek

Timeline for d5vpib1:

• d5vpib1 is new in SCOPe 2.06-stable
  
• d5vpib1 appears in SCOPe 2.07
  
• d5vpib1 appears in the current release, SCOPe 2.08