Lineage for d2dpma_ (2dpm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130081Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 protein domains)
    automatically mapped to Pfam PF02086
  6. 2130082Protein DNA methylase DpnM [53373] (1 species)
  7. 2130083Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [53374] (1 PDB entry)
  8. 2130084Domain d2dpma_: 2dpm A: [34246]
    protein/DNA complex; complexed with hg, sam

Details for d2dpma_

PDB Entry: 2dpm (more details), 1.8 Å

PDB Description: dpnm dna adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
PDB Compounds: (A:) protein (adenine-specific methyltransferase dpnii 1)

SCOPe Domain Sequences for d2dpma_:

Sequence, based on SEQRES records: (download)

>d2dpma_ c.66.1.28 (A:) DNA methylase DpnM {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tlqpftkwtggkrqllpvirelipktynryfepfvgggalffdlapkdavindfnaelin
cyqqikdnpqelieilkvhqeynskeyyldlrsadrderidmmsevqraarilymlrvnf
nglyrvnsknqfnvpygryknpkivdeelisaisvyinnnqleikvgdfekaivdvrtgd
fvyfdppyiplsetsaftsythegfsfadqvrlrdafkrlsdtgayvmlsnsssalveel
ykdfnihyveatrtngaksssrgkiseiivtnyek

Sequence, based on observed residues (ATOM records): (download)

>d2dpma_ c.66.1.28 (A:) DNA methylase DpnM {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tlqpftkwtggkrqllpvirelipktynryfepfvgggalffdlapkdavindfnaelin
cyqqikdnpqelieilkvhqeynskeyyldlrsadrderidmmsevqraarilymlrvnf
nglyrvnsknqfnvpygryknpkivdeelisaisvyinnnqleikvgdfekaivdvrtgd
fvyfdppyiplftsythegfsfadqvrlrdafkrlsdtgayvmlsnsssalveelykdfn
ihyvegkiseiivtnyek

SCOPe Domain Coordinates for d2dpma_:

Click to download the PDB-style file with coordinates for d2dpma_.
(The format of our PDB-style files is described here.)

Timeline for d2dpma_: