Lineage for d1dctb_ (1dct B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125656Family c.66.1.10: DNA methylases [53366] (5 proteins)
  6. 125657Protein DNA methylase HaeIII, coenzyme-binding domain [53371] (1 species)
  7. 125658Species Haemophilus aegyptius [TaxId:197575] [53372] (1 PDB entry)
  8. 125660Domain d1dctb_: 1dct B: [34245]

Details for d1dctb_

PDB Entry: 1dct (more details), 2.8 Å

PDB Description: dna (cytosine-5) methylase from haeiii covalently bound to dna

SCOP Domain Sequences for d1dctb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dctb_ c.66.1.10 (B:) DNA methylase HaeIII, coenzyme-binding domain {Haemophilus aegyptius}
mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
kcdgiiggppcqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
ykmignavpvnlayeiaktiksal

SCOP Domain Coordinates for d1dctb_:

Click to download the PDB-style file with coordinates for d1dctb_.
(The format of our PDB-style files is described here.)

Timeline for d1dctb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dcta_