Lineage for d5wafd_ (5waf D:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245346Species Acinetobacter baumannii [TaxId:470] [194613] (47 PDB entries)
  8. 2245422Domain d5wafd_: 5waf D: [342447]
    automated match to d4neta_
    complexed with a0y

Details for d5wafd_

PDB Entry: 5waf (more details), 2.03 Å

PDB Description: adc-7 in complex with boronic acid transition state inhibitor cr192
PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d5wafd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wafd_ e.3.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]}
pkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntifel
gsvsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalqfp
devqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifpal
glkhsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanlnpq
kyptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvtais
kepsvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnai

SCOPe Domain Coordinates for d5wafd_:

Click to download the PDB-style file with coordinates for d5wafd_.
(The format of our PDB-style files is described here.)

Timeline for d5wafd_: