![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d5vf2a2: 5vf2 A:138-251 [342446] automated match to d4h0hb2 complexed with mes, mg, unx |
PDB Entry: 5vf2 (more details), 1.55 Å
SCOPe Domain Sequences for d5vf2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vf2a2 b.1.1.0 (A:138-251) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gsdvvmtqtpfslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsn rfsgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpytfgggtkleik
Timeline for d5vf2a2: