SCOPe 2.08: Domain d5vf2a1: 5vf2 A:1-123

Lineage for d5vf2a1 (5vf2 A:1-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5vf2a1: 5vf2 A:1-123 [342445]
   automated match to d4h0hb1
   complexed with mes, mg, unx

Details for d5vf2a1

PDB Entry: 5vf2, 1.55 Å

PDB Description: scfv 2d10 re-refined as a complex with trehalose replacing the original alpha-1,6-mannobiose

PDB Compounds: (A:) scFv 2D10

SCOPe Domain Sequences for d5vf2a1:

Sequence; same for both SEQRES and ATOM records:

>d5vf2a1 b.1.1.0 (A:1-123) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
meiqlqqsgpelvkpgasvkisckasgysftdyimlwvkqshgkslewigninpyygsts
ynlkfkgkatltvdkssstaymqlnsltsedsavyycarknyygssldywgqgttltvss
akt

Timeline for d5vf2a1:

• d5vf2a1 first appeared in SCOPe 2.06
  
• d5vf2a1 appears in SCOPe 2.07