![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Thermococcus kodakarensis [TaxId:311400] [342432] (1 PDB entry) |
![]() | Domain d5vu5a1: 5vu5 A:1-347 [342433] Other proteins in same PDB: d5vu5a2 automated match to d3a2fa1 |
PDB Entry: 5vu5 (more details), 2.8 Å
SCOPe Domain Sequences for d5vu5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vu5a1 c.55.3.0 (A:1-347) automated matches {Thermococcus kodakarensis [TaxId: 311400]} mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry lidkglvpmegdeelkmlafaiatlyhegeefaegpilmisyadeegarvitwknvdlpy vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs
Timeline for d5vu5a1: