SCOPe 2.07: Domain d5vu5a1: 5vu5 A:1-347

Lineage for d5vu5a1 (5vu5 A:1-347)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:311400] [342432] (1 PDB entry)

8. Domain d5vu5a1: 5vu5 A:1-347 [342433]
   Other proteins in same PDB: d5vu5a2
   automated match to d3a2fa1

Details for d5vu5a1

PDB Entry: 5vu5, 2.8 Å

PDB Description: tna polymerase, apo

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d5vu5a1:

Sequence; same for both SEQRES and ATOM records:

>d5vu5a1 c.55.3.0 (A:1-347) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafaiatlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

Timeline for d5vu5a1:

• d5vu5a1 first appeared in SCOPe 2.06
  
• d5vu5a1 appears in the current release, SCOPe 2.08