Lineage for d5vu5a1 (5vu5 A:1-347)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887515Species Thermococcus kodakarensis [TaxId:311400] [342432] (1 PDB entry)
  8. 2887516Domain d5vu5a1: 5vu5 A:1-347 [342433]
    Other proteins in same PDB: d5vu5a2
    automated match to d3a2fa1

Details for d5vu5a1

PDB Entry: 5vu5 (more details), 2.8 Å

PDB Description: tna polymerase, apo
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d5vu5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vu5a1 c.55.3.0 (A:1-347) automated matches {Thermococcus kodakarensis [TaxId: 311400]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafaiatlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

SCOPe Domain Coordinates for d5vu5a1:

Click to download the PDB-style file with coordinates for d5vu5a1.
(The format of our PDB-style files is described here.)

Timeline for d5vu5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vu5a2