Lineage for d5u0za_ (5u0z A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425526Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2425527Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2425528Protein Dihydropteroate synthetase [51719] (5 species)
  7. 2425598Species Escherichia coli [TaxId:199310] [342362] (11 PDB entries)
  8. 2425617Domain d5u0za_: 5u0z A: [342405]
    Other proteins in same PDB: d5u0zb2
    automated match to d1aj2a_
    complexed with 7pm

Details for d5u0za_

PDB Entry: 5u0z (more details), 2.29 Å

PDB Description: e. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d5u0za_:

Sequence, based on SEQRES records: (download)

>d5u0za_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 199310]}
mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
acaviaamqgahiirvhdvketveamrvveatlsakenkrye

Sequence, based on observed residues (ATOM records): (download)

>d5u0za_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 199310]}
mklfaqgtsldlshphvmgilnvtnslidavkhanlminagatiidvggestrpgaaevs
veeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirslsepgaleaaa
etglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiakekllldpgfgf
gknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgslacaviaamqg
ahiirvhdvketveamrvveatlsakenkrye

SCOPe Domain Coordinates for d5u0za_:

Click to download the PDB-style file with coordinates for d5u0za_.
(The format of our PDB-style files is described here.)

Timeline for d5u0za_: