SCOPe 2.08: Domain d5ukpl2: 5ukp L:108-208

Lineage for d5ukpl2 (5ukp L:108-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d5ukpl2: 5ukp L:108-208 [342402]
   Other proteins in same PDB: d5ukph1, d5ukph2, d5ukpl1
   automated match to d1aqkl2

Details for d5ukpl2

PDB Entry: 5ukp, 2 Å

PDB Description: structure of unliganded anti-gp120 cd4bs antibody dh522.1 fab

PDB Compounds: (L:) DH522.1 Fab fragment light chain

SCOPe Domain Sequences for d5ukpl2:

Sequence; same for both SEQRES and ATOM records:

>d5ukpl2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasptvtlfppsseelqankatlvclisdfypgvvkvawkadgsavnagvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvap

Timeline for d5ukpl2:

• d5ukpl2 first appeared in SCOPe 2.06
  
• d5ukpl2 appears in SCOPe 2.07