Lineage for d5u13a_ (5u13 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101987Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2101988Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 2101989Protein Dihydropteroate synthetase [51719] (5 species)
  7. 2102059Species Escherichia coli [TaxId:199310] [342362] (11 PDB entries)
  8. 2102066Domain d5u13a_: 5u13 A: [342383]
    Other proteins in same PDB: d5u13b2
    automated match to d1aj2a_
    complexed with yh5

Details for d5u13a_

PDB Entry: 5u13 (more details), 1.95 Å

PDB Description: e. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative: 2-amino-8-{[2-(4-methoxyphenyl)-2-oxoethyl]sulfanyl}-1,7- dihydro-6h-purin-6-one
PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d5u13a_:

Sequence, based on SEQRES records: (download)

>d5u13a_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 199310]}
mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
acaviaamqgahiirvhdvketveamrvveatlsakenkrye

Sequence, based on observed residues (ATOM records): (download)

>d5u13a_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 199310]}
mklfaqgtsldlshphvmgilnvtnslidavkhanlminagatiidvggestrpgaaevs
veeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirslsepgaleaaa
etglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiakekllldpgfgf
gknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgslacaviaamqg
ahiirvhdvketveamrvveatlsakenkrye

SCOPe Domain Coordinates for d5u13a_:

Click to download the PDB-style file with coordinates for d5u13a_.
(The format of our PDB-style files is described here.)

Timeline for d5u13a_: