| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries) |
| Domain d5ukol2: 5uko L:108-208 [342379] Other proteins in same PDB: d5ukoh1, d5ukoh2, d5ukol1 automated match to d1aqkl2 |
PDB Entry: 5uko (more details), 2.3 Å
SCOPe Domain Sequences for d5ukol2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ukol2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasptvtlfppsseelqankatlvclisdfypgvvkvawkadgsavnagvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvap
Timeline for d5ukol2: