SCOP 1.63: Domain d5mhta_: 5mht A:

Lineage for d5mhta_ (5mht A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (23 families)

5. Family c.66.1.10: DNA methylases [53366] (5 proteins)

6. Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species)

7. Species Haemophilus haemolyticus [TaxId:726] [53368] (13 PDB entries)

8. Domain d5mhta_: 5mht A: [34237]
   protein/DNA complex; complexed with 5cm, sah

Details for d5mhta_

PDB Entry: 5mht, 2.7 Å

PDB Description: ternary structure of hhai methyltransferase with hemimethylated dna and adohcy

SCOP Domain Sequences for d5mhta_:

Sequence; same for both SEQRES and ATOM records:

>d5mhta_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d5mhta_:

• d5mhta_ first appeared (with stable ids) in SCOP 1.55
  
• d5mhta_ appears in SCOP 1.61
  
• d5mhta_ appears in SCOP 1.65
  
• d5mhta_ appears in the current release, SCOPe 2.08