Lineage for d5nbqa_ (5nbq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330425Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2330698Family a.102.4.4: Complement components [48251] (4 protein domains)
    probably related to other families, but has no known enzymatic activity
  6. 2330702Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2330703Species Human (Homo sapiens) [TaxId:9606] [48253] (17 PDB entries)
  8. 2330733Domain d5nbqa_: 5nbq A: [342361]
    automated match to d2wy8a_

Details for d5nbqa_

PDB Entry: 5nbq (more details), 3.18 Å

PDB Description: the structure of the tripartite complex between ospe, the c-terminal domains of factor h and c3dg
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d5nbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nbqa_ a.102.4.4 (A:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]}
daerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgytq
qlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqkpd
gvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkagdf
leanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveatsy
allallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkd

SCOPe Domain Coordinates for d5nbqa_:

Click to download the PDB-style file with coordinates for d5nbqa_.
(The format of our PDB-style files is described here.)

Timeline for d5nbqa_: