SCOPe 2.08: Domain d5olce2: 5olc E:124-376

Lineage for d5olce2 (5olc E:124-376)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Zobellia galactanivorans [TaxId:63186] [342332] (1 PDB entry)

8. Domain d5olce2: 5olc E:124-376 [342340]
   Other proteins in same PDB: d5olca1, d5olca3, d5olcb1, d5olcb3, d5olcc1, d5olcc3, d5olcd1, d5olcd3, d5olce1, d5olce3, d5olcf1, d5olcf3, d5olcg1, d5olcg3, d5olch1, d5olch3
   automated match to d4ggba2
   complexed with mg

Details for d5olce2

PDB Entry: 5olc, 2.79 Å

PDB Description: crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans

PDB Compounds: (E:) Galactonate dehydratase

SCOPe Domain Sequences for d5olce2:

Sequence, based on SEQRES records:

>d5olce2 c.1.11.0 (E:124-376) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgieqdlkyiaairk
aigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgykrlrqnttipis
ggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwia
isaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklenghlevpctpglgv
dvdmdklehyldk

Sequence, based on observed residues (ATOM records):

>d5olce2 c.1.11.0 (E:124-376) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vknpiiepyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdm
rlmidsnhaycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggecey
lkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavh
lvanldlptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk

Timeline for d5olce2:

• d5olce2 first appeared in SCOPe 2.06
  
• d5olce2 appears in SCOPe 2.07