![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (79 species) not a true protein |
![]() | Species Zobellia galactanivorans [TaxId:63186] [342332] (1 PDB entry) |
![]() | Domain d5olcc2: 5olc C:124-376 [342333] Other proteins in same PDB: d5olca1, d5olca3, d5olcb1, d5olcb3, d5olcc1, d5olcc3, d5olcd1, d5olcd3, d5olce1, d5olce3, d5olcf1, d5olcf3, d5olcg1, d5olcg3, d5olch1, d5olch3 automated match to d4ggba2 complexed with mg |
PDB Entry: 5olc (more details), 2.79 Å
SCOPe Domain Sequences for d5olcc2:
Sequence, based on SEQRES records: (download)
>d5olcc2 c.1.11.0 (C:124-376) automated matches {Zobellia galactanivorans [TaxId: 63186]} vknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgieqdlkyiaairk aigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgykrlrqnttipis ggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwia isaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklenghlevpctpglgv dvdmdklehyldk
>d5olcc2 c.1.11.0 (C:124-376) automated matches {Zobellia galactanivorans [TaxId: 63186]} vknpiiepyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdm rlmidsnhaycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggecey lkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavh lvanldlptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
Timeline for d5olcc2: