SCOPe 2.05: Domain d8mhta_: 8mht A:

Lineage for d8mhta_ (8mht A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
   automatically mapped to Pfam PF00145

6. Protein DNA methylase HhaI [53367] (2 species)

7. Species Haemophilus haemolyticus [TaxId:726] [53368] (16 PDB entries)
   Uniprot P05102

8. Domain d8mhta_: 8mht A: [34233]
   protein/DNA complex; complexed with sah

Details for d8mhta_

PDB Entry: 8mht, 2.76 Å

PDB Description: cytosine-specific methyltransferase hhai/dna complex

PDB Compounds: (A:) cytosine-specific methyltransferase hhai

SCOPe Domain Sequences for d8mhta_:

Sequence; same for both SEQRES and ATOM records:

>d8mhta_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d8mhta_:

• d8mhta_ first appeared (with stable ids) in SCOP 1.55
  
• d8mhta_ appears in SCOPe 2.04
  
• d8mhta_ appears in SCOPe 2.06
  
• d8mhta_ appears in the current release, SCOPe 2.08