Lineage for d8mhta_ (8mht A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 588970Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)
  6. 588975Protein DNA methylase HhaI [53367] (1 species)
  7. 588976Species Haemophilus haemolyticus [TaxId:726] [53368] (15 PDB entries)
  8. 588986Domain d8mhta_: 8mht A: [34233]
    protein/DNA complex; complexed with 2up, sah

Details for d8mhta_

PDB Entry: 8mht (more details), 2.76 Å

PDB Description: cytosine-specific methyltransferase hhai/dna complex

SCOP Domain Sequences for d8mhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8mhta_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d8mhta_:

Click to download the PDB-style file with coordinates for d8mhta_.
(The format of our PDB-style files is described here.)

Timeline for d8mhta_: