Lineage for d10mha_ (10mh A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125656Family c.66.1.10: DNA methylases [53366] (5 proteins)
  6. 125661Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species)
  7. 125662Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries)
  8. 125666Domain d10mha_: 10mh A: [34232]

Details for d10mha_

PDB Entry: 10mh (more details), 2.55 Å

PDB Description: ternary structure of hhai methyltransferase with adohcy and hemimethylated dna containing 5,6-dihydro-5-azacytosine at the target

SCOP Domain Sequences for d10mha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d10mha_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d10mha_:

Click to download the PDB-style file with coordinates for d10mha_.
(The format of our PDB-style files is described here.)

Timeline for d10mha_: