Lineage for d5nwma1 (5nwm A:257-385)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577142Family d.110.3.8: PAS domain of steroid receptor coactivator 1A, NCo-A1 [103187] (2 proteins)
  6. 2577147Protein automated matches [342317] (1 species)
    not a true protein
  7. 2577148Species Human (Homo sapiens) [TaxId:9606] [342318] (1 PDB entry)
  8. 2577149Domain d5nwma1: 5nwm A:257-385 [342319]
    Other proteins in same PDB: d5nwma2
    automated match to d1oj5a_

Details for d5nwma1

PDB Entry: 5nwm (more details)

PDB Description: insight into the molecular recognition mechanism of the coactivator ncoa1 by stat6
PDB Compounds: (A:) Nuclear receptor coactivator 1

SCOPe Domain Sequences for d5nwma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nwma1 d.110.3.8 (A:257-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqe
vmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglspqdd
tnsgmsipr

SCOPe Domain Coordinates for d5nwma1:

Click to download the PDB-style file with coordinates for d5nwma1.
(The format of our PDB-style files is described here.)

Timeline for d5nwma1: