SCOPe 2.06: Domain d5nwma1: 5nwm A:257-385

Lineage for d5nwma1 (5nwm A:257-385)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.8: PAS domain of steroid receptor coactivator 1A, NCo-A1 [103187] (2 proteins)

6. Protein automated matches [342317] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [342318] (1 PDB entry)

8. Domain d5nwma1: 5nwm A:257-385 [342319]
   Other proteins in same PDB: d5nwma2
   automated match to d1oj5a_

Details for d5nwma1

PDB Entry: 5nwm

PDB Description: insight into the molecular recognition mechanism of the coactivator ncoa1 by stat6

PDB Compounds: (A:) Nuclear receptor coactivator 1

SCOPe Domain Sequences for d5nwma1:

Sequence; same for both SEQRES and ATOM records:

>d5nwma1 d.110.3.8 (A:257-385) automated matches {Homo sapiens [TaxId: 9606]}
tgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqe
vmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglspqdd
tnsgmsipr

Timeline for d5nwma1:

• d5nwma1 is new in SCOPe 2.06-stable
  
• d5nwma1 appears in SCOPe 2.07
  
• d5nwma1 appears in the current release, SCOPe 2.08