![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.8: PAS domain of steroid receptor coactivator 1A, NCo-A1 [103187] (2 proteins) |
![]() | Protein automated matches [342317] (1 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [342318] (1 PDB entry) |
![]() | Domain d5nwma1: 5nwm A:257-385 [342319] Other proteins in same PDB: d5nwma2 automated match to d1oj5a_ |
PDB Entry: 5nwm (more details)
SCOPe Domain Sequences for d5nwma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nwma1 d.110.3.8 (A:257-385) automated matches {Homo sapiens [TaxId: 9606]} tgvesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqe vmtrgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidrehsglspqdd tnsgmsipr
Timeline for d5nwma1: