![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (30 families) ![]() |
![]() | Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins) |
![]() | Protein DNA methylase HhaI [53367] (1 species) |
![]() | Species Haemophilus haemolyticus [TaxId:726] [53368] (13 PDB entries) |
![]() | Domain d7mhta_: 7mht A: [34231] protein/DNA complex; complexed with sah |
PDB Entry: 7mht (more details), 2.87 Å
SCOP Domain Sequences for d7mhta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mhta_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus} mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk qfgnsvvinvlqyiaynigsslnfkpy
Timeline for d7mhta_: