SCOPe 2.08: Domain d6bitl2: 6bit L:108-211

Lineage for d6bitl2 (6bit L:108-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d6bitl2: 6bit L:108-211 [342308]
Other proteins in same PDB: d6bitg_, d6bith_, d6biti_, d6bitj_, d6bitk1, d6bitl1
automated match to d2dtgb2

Details for d6bitl2

PDB Entry: 6bit (more details), 2.19 Å

PDB Description: sirpalpha antibody complex

PDB Compounds: (L:) KWAR23 Fab light chain

SCOPe Domain Sequences for d6bitl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bitl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d6bitl2:

Click to download the PDB-style file with coordinates for d6bitl2.
(The format of our PDB-style files is described here.)

Timeline for d6bitl2: