Lineage for d4mhta_ (4mht A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125656Family c.66.1.10: DNA methylases [53366] (5 proteins)
  6. 125661Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species)
  7. 125662Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries)
  8. 125668Domain d4mhta_: 4mht A: [34230]

Details for d4mhta_

PDB Entry: 4mht (more details), 2.7 Å

PDB Description: ternary structure of hhai methyltransferase with native dna and adohcy

SCOP Domain Sequences for d4mhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhta_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d4mhta_:

Click to download the PDB-style file with coordinates for d4mhta_.
(The format of our PDB-style files is described here.)

Timeline for d4mhta_: