SCOPe 2.07: Domain d5n9rb_: 5n9r B:

Lineage for d5n9rb_ (5n9r B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
   Pfam PF00443

6. Protein Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) [82569] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82570] (25 PDB entries)

8. Domain d5n9rb_: 5n9r B: [342299]
   Other proteins in same PDB: d5n9ra2
   automated match to d1nb8b_
   complexed with 8rn, dms, gol, so4

Details for d5n9rb_

PDB Entry: 5n9r, 2.23 Å

PDB Description: crystal structure of usp7 in complex with a potent, selective and reversible small-molecule inhibitor

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 7

SCOPe Domain Sequences for d5n9rb_:

Sequence; same for both SEQRES and ATOM records:

>d5n9rb_ d.3.1.9 (B:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}
mskkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfy
elqhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfr
gkmvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehg
lqeaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdp
anyilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddl
svrhctnaymlvyiresklsevlqavtdhdipqqlverlqeekriea

Timeline for d5n9rb_:

• d5n9rb_ first appeared in SCOPe 2.06
  
• d5n9rb_ appears in the current release, SCOPe 2.08