SCOP 1.71: Domain d1hmy__: 1hmy -

Lineage for d1hmy__ (1hmy -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)

6. Protein DNA methylase HhaI [53367] (1 species)

7. Species Haemophilus haemolyticus [TaxId:726] [53368] (15 PDB entries)

8. Domain d1hmy__: 1hmy - [34229]
   complexed with sam

Details for d1hmy__

PDB Entry: 1hmy, 2.5 Å

PDB Description: crystal structure of the hhai dna methyltransferase complexed with s-adenosyl-l-methionine

SCOP Domain Sequences for d1hmy__:

Sequence; same for both SEQRES and ATOM records:

>d1hmy__ c.66.1.26 (-) DNA methylase HhaI {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d1hmy__:

• d1hmy__ first appeared (with stable ids) in SCOP 1.55
  
• d1hmy__ appears in SCOP 1.69
  
• d1hmy__ is called d1hmya_ in SCOP 1.73
  
• d1hmy__ appears in the current release, SCOPe 2.08, called d1hmya_