Lineage for d1hmy__ (1hmy -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (13 families) 
Family c.66.1.10: DNA methylases [53366] (5 proteins) 
Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species) Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries) 
Domain d1hmy__: 1hmy - [34229]
Details for d1hmy__
PDB Entry: 1hmy (more details), 2.5 Å
PDB Description: crystal structure of the hhai dna methyltransferase complexed with s-adenosyl-l-methionine
SCOP Domain Sequences for d1hmy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hmy__ c.66.1.10 (-) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy
SCOP Domain Coordinates for d1hmy__:
Click to download the PDB-style file with coordinates for d1hmy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hmy__:
- d1hmy__ first appeared (with stable ids) in SCOP 1.55
- d1hmy__ appears in SCOP 1.59
- d1hmy__ appears in the current release, SCOPe 2.08, called d1hmya_
View in 3D