SCOP 1.75: Domain d1fjxa_: 1fjx A:

Lineage for d1fjxa_ (1fjx A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)

6. Protein DNA methylase HhaI [53367] (1 species)

7. Species Haemophilus haemolyticus [TaxId:726] [53368] (20 PDB entries)
   Uniprot P05102

8. Domain d1fjxa_: 1fjx A: [34228]
   protein/DNA complex; complexed with sah, so4; mutant

Details for d1fjxa_

PDB Entry: 1fjx, 2.26 Å

PDB Description: structure of ternary complex of hhai methyltransferase mutant (t250g) in complex with dna and adohcy

PDB Compounds: (A:) hhai DNA methyltransferase

SCOP Domain Sequences for d1fjxa_:

Sequence; same for both SEQRES and ATOM records:

>d1fjxa_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaiglsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d1fjxa_:

• d1fjxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjxa_ appears in SCOP 1.73
  
• d1fjxa_ appears in SCOPe 2.01
  
• d1fjxa_ appears in the current release, SCOPe 2.08