Lineage for d1fjxa_ (1fjx A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72963Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 72964Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (13 families) (S)
  5. 73045Family c.66.1.10: DNA methylases [53366] (5 proteins)
  6. 73050Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species)
  7. 73051Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries)
  8. 73053Domain d1fjxa_: 1fjx A: [34228]

Details for d1fjxa_

PDB Entry: 1fjx (more details), 2.26 Å

PDB Description: structure of ternary complex of hhai methyltransferase mutant (t250g) in complex with dna and adohcy

SCOP Domain Sequences for d1fjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjxa_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaiglsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d1fjxa_:

Click to download the PDB-style file with coordinates for d1fjxa_.
(The format of our PDB-style files is described here.)

Timeline for d1fjxa_: