Lineage for d5j82a_ (5j82 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2579779Protein HSP90 [55876] (3 species)
  7. 2579883Species Human (Homo sapiens) [TaxId:9606] [55878] (146 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2580041Domain d5j82a_: 5j82 A: [342273]
    automated match to d2xjxa_
    complexed with 6gv

Details for d5j82a_

PDB Entry: 5j82 (more details), 2.17 Å

PDB Description: crystal structure of hsp90-alpha n-domain in complex 5-[4-(2-fluoro- phenyl)-5-oxo-4,5-dihydro-1h-[1,2,4]triazol-3-yl]-2,4-dihydroxy-n- isopropyl-n-methyl-benzenesulfonamide
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5j82a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j82a_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d5j82a_:

Click to download the PDB-style file with coordinates for d5j82a_.
(The format of our PDB-style files is described here.)

Timeline for d5j82a_: