SCOPe 2.06: Domain d5gmqc2: 5gmq C:106-210

Lineage for d5gmqc2 (5gmq C:106-210)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5gmqc2: 5gmq C:106-210 [342260]
   Other proteins in same PDB: d5gmqc1
   automated match to d1dn0a2
   complexed with edo, man, nag

Details for d5gmqc2

PDB Entry: 5gmq, 2.7 Å

PDB Description: structure of mers-cov rbd in complex with a fully human antibody mca1

PDB Compounds: (C:) MCA1 light chain

SCOPe Domain Sequences for d5gmqc2:

Sequence, based on SEQRES records:

>d5gmqc2 b.1.1.2 (C:106-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records):

>d5gmqc2 b.1.1.2 (C:106-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdlqsgnsqesvteqds
kdstyslsstltlskadyekhkyacevthqglsspvtksfnr

Timeline for d5gmqc2:

• d5gmqc2 is new in SCOPe 2.06-stable
  
• d5gmqc2 appears in SCOPe 2.07
  
• d5gmqc2 appears in the current release, SCOPe 2.08