SCOPe 2.08: Domain d6b3sk2: 6b3s K:108-213

Lineage for d6b3sk2 (6b3s K:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6b3sk2: 6b3s K:108-213 [342258]
   Other proteins in same PDB: d6b3sa1, d6b3sa2, d6b3sb1, d6b3sb2, d6b3sb3, d6b3se1, d6b3se2, d6b3se3, d6b3si1, d6b3si2, d6b3si3
   automated match to d3b2ud2
   complexed with nag

Details for d6b3sk2

PDB Entry: 6b3s, 2.8 Å

PDB Description: crystal structure of the fab fragment of necitumumab (fab11f8) in complex with domain iii from a cetuximab resistant variant of egfr (segfrd3-s468r)

PDB Compounds: (K:) Necitumumab Fab Light chain

SCOPe Domain Sequences for d6b3sk2:

Sequence; same for both SEQRES and ATOM records:

>d6b3sk2 b.1.1.0 (K:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrga

Timeline for d6b3sk2:

• d6b3sk2 first appeared in SCOPe 2.06
  
• d6b3sk2 appears in SCOPe 2.07