![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (37 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (8 PDB entries) |
![]() | Domain d6elkc2: 6elk C:86-194 [342248] Other proteins in same PDB: d6elka1, d6elkc1 automated match to d3dc5a2 complexed with gol, mn, so4; mutant |
PDB Entry: 6elk (more details), 1.65 Å
SCOPe Domain Sequences for d6elkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6elkc2 d.44.1.0 (C:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanhdpl egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq
Timeline for d6elkc2: