Lineage for d6elkc2 (6elk C:86-194)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553345Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (8 PDB entries)
  8. 2553357Domain d6elkc2: 6elk C:86-194 [342248]
    Other proteins in same PDB: d6elka1, d6elkc1
    automated match to d3dc5a2
    complexed with gol, mn, so4; mutant

Details for d6elkc2

PDB Entry: 6elk (more details), 1.65 Å

PDB Description: c.elegans mnsod-3 mutant - q142h
PDB Compounds: (C:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d6elkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elkc2 d.44.1.0 (C:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanhdpl
egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq

SCOPe Domain Coordinates for d6elkc2:

Click to download the PDB-style file with coordinates for d6elkc2.
(The format of our PDB-style files is described here.)

Timeline for d6elkc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6elkc1