Lineage for d6elkc1 (6elk C:1-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690503Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (8 PDB entries)
  8. 2690515Domain d6elkc1: 6elk C:1-85 [342247]
    Other proteins in same PDB: d6elka2, d6elkc2
    automated match to d3dc5a1
    complexed with gol, mn, so4; mutant

Details for d6elkc1

PDB Entry: 6elk (more details), 1.65 Å

PDB Description: c.elegans mnsod-3 mutant - q142h
PDB Compounds: (C:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d6elkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elkc1 a.2.11.0 (C:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
qpalkfnggghinhsifwtnlakdg

SCOPe Domain Coordinates for d6elkc1:

Click to download the PDB-style file with coordinates for d6elkc1.
(The format of our PDB-style files is described here.)

Timeline for d6elkc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6elkc2