SCOPe 2.06: Domain d6bkvb1: 6bkv B:1-105

Lineage for d6bkvb1 (6bkv B:1-105)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [186917] (2 PDB entries)

8. Domain d6bkvb1: 6bkv B:1-105 [342236]
   Other proteins in same PDB: d6bkva2, d6bkvb2
   automated match to d2l4qa_

Details for d6bkvb1

PDB Entry: 6bkv, 2.35 Å

PDB Description: crystal structure of thioredoxin from helicobacter pylori (strain g27)

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d6bkvb1:

Sequence; same for both SEQRES and ATOM records:

>d6bkvb1 c.47.1.0 (B:1-105) automated matches {Helicobacter pylori [TaxId: 210]}
mshyielteenfestikkgvalvdfwapwcgpckmlspvidelaseyqgkakickvntde
qeelsakfgirsiptllftkdgevvhqlvgvqtkvalkeqlnkll

Timeline for d6bkvb1:

• d6bkvb1 is new in SCOPe 2.06-stable
  
• d6bkvb1 appears in SCOPe 2.07
  
• d6bkvb1 appears in the current release, SCOPe 2.08