![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
![]() | Protein automated matches [190903] (22 species) not a true protein |
![]() | Species Burkholderia lata [TaxId:482957] [332738] (2 PDB entries) |
![]() | Domain d6blmb2: 6blm B:67-128 [342231] automated match to d4x1ch_ |
PDB Entry: 6blm (more details), 1.49 Å
SCOPe Domain Sequences for d6blmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6blmb2 d.80.1.0 (B:67-128) automated matches {Burkholderia lata [TaxId: 482957]} pvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggqtaral gr
Timeline for d6blmb2:
![]() Domains from other chains: (mouse over for more information) d6blma1, d6blma2, d6blmc1, d6blmc2 |