Lineage for d6blmb2 (6blm B:67-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961467Species Burkholderia lata [TaxId:482957] [332738] (2 PDB entries)
  8. 2961471Domain d6blmb2: 6blm B:67-128 [342231]
    automated match to d4x1ch_

Details for d6blmb2

PDB Entry: 6blm (more details), 1.49 Å

PDB Description: crystal structure of native fused 4-ot
PDB Compounds: (B:) 4-oxalocrotonate tautomerase

SCOPe Domain Sequences for d6blmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6blmb2 d.80.1.0 (B:67-128) automated matches {Burkholderia lata [TaxId: 482957]}
pvivailiagrtdeqkraliaalsetsasvldaplqatrvmikdipntdfgiggqtaral
gr

SCOPe Domain Coordinates for d6blmb2:

Click to download the PDB-style file with coordinates for d6blmb2.
(The format of our PDB-style files is described here.)

Timeline for d6blmb2: