Lineage for d6b3sb1 (6b3s B:311-480)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111641Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2111692Protein automated matches [232361] (1 species)
    not a true protein
  7. 2111693Species Human (Homo sapiens) [TaxId:9606] [232384] (6 PDB entries)
  8. 2111706Domain d6b3sb1: 6b3s B:311-480 [342227]
    Other proteins in same PDB: d6b3sa2, d6b3sb2, d6b3sb3, d6b3sd1, d6b3sd2, d6b3se2, d6b3se3, d6b3sg1, d6b3sg2, d6b3si2, d6b3si3, d6b3sk1, d6b3sk2, d6b3sl1, d6b3sl2
    automated match to d1moxa2
    complexed with bma, man, nag

Details for d6b3sb1

PDB Entry: 6b3s (more details), 2.8 Å

PDB Description: crystal structure of the fab fragment of necitumumab (fab11f8) in complex with domain iii from a cetuximab resistant variant of egfr (segfrd3-s468r)
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d6b3sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b3sb1 c.10.2.5 (B:311-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi
lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslk
eisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgq

SCOPe Domain Coordinates for d6b3sb1:

Click to download the PDB-style file with coordinates for d6b3sb1.
(The format of our PDB-style files is described here.)

Timeline for d6b3sb1: