SCOPe 2.07: Domain d6b89b_: 6b89 B:

Lineage for d6b89b_ (6b89 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [334882] (8 PDB entries)

8. Domain d6b89b_: 6b89 B: [342226]
   automated match to d4wbsa_
   complexed with adp, mg, nov

Details for d6b89b_

PDB Entry: 6b89, 2 Å

PDB Description: e. coli lptb in complex with adp and novobiocin

PDB Compounds: (B:) Lipopolysaccharide export system ATP-binding protein LptB

SCOPe Domain Sequences for d6b89b_:

Sequence; same for both SEQRES and ATOM records:

>d6b89b_ c.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
atltaknlakaykgrrvvedvsltvnsgeivgllgpngagktttfymvvgivprdagnii
iddddisllplhararrgigylpqeasifrrlsvydnlmavlqirddlsaeqredranel
meefhiehlrdsmgqslsggerrrveiaralaanpkfilldepfagvdpisvidikriie
hlrdsglgvlitdhnvretlavcerayivsqghliahgtpteilqd

Timeline for d6b89b_:

• d6b89b_ first appeared in SCOPe 2.06
  
• d6b89b_ appears in the current release, SCOPe 2.08