| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) ![]() there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
| Family a.223.1.0: automated matches [256442] (1 protein) not a true family |
| Protein automated matches [256443] (3 species) not a true protein |
| Species Escherichia coli [TaxId:562] [342133] (2 PDB entries) |
| Domain d5owjb3: 5owj B:248-432 [342211] Other proteins in same PDB: d5owja1, d5owja2, d5owjb1, d5owjb2 automated match to d1w26a1 |
PDB Entry: 5owj (more details)
SCOPe Domain Sequences for d5owjb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5owjb3 a.223.1.0 (B:248-432) automated matches {Escherichia coli [TaxId: 562]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa
Timeline for d5owjb3: