Lineage for d1qana_ (1qan A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893551Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)
  6. 2893561Protein rRNA adenine dimethylase [53363] (2 species)
    contains additional all-alpha C-terminal domain (res.181-248)
  7. 2893562Species Bacillus subtilis, Ermc' [TaxId:1423] [53365] (5 PDB entries)
  8. 2893564Domain d1qana_: 1qan A: [34221]
    protein/RNA complex; complexed with act, sah

Details for d1qana_

PDB Entry: 1qan (more details), 2.4 Å

PDB Description: the structure of the rrna methyltransferase ermc': implications for the reaction mechanism
PDB Compounds: (A:) ermc' methyltransferase

SCOPe Domain Sequences for d1qana_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qana_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}
sqnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktt
enklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylive
ygfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdk
qkynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk

SCOPe Domain Coordinates for d1qana_:

Click to download the PDB-style file with coordinates for d1qana_.
(The format of our PDB-style files is described here.)

Timeline for d1qana_: