Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Bacillus subtilis [TaxId:655816] [341938] (5 PDB entries) |
Domain d5y8tb_: 5y8t B: [342206] automated match to d1yg2a_ complexed with hc4 |
PDB Entry: 5y8t (more details), 2 Å
SCOPe Domain Sequences for d5y8tb_:
Sequence, based on SEQRES records: (download)
>d5y8tb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]} rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrttiq gtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdql lkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswlesilamide
>d5y8tb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]} rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrtkkm ytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkakls dlqgsyeklmapmsfsspdfghylvltkalereknyvswlesilamide
Timeline for d5y8tb_: